Receptor Accessory Protein 4 anticorps (N-Term)

N° du produit ABIN635929

Détail du produit anti-Receptor Accessory Protein 4 anticorps

Antigène: Receptor Accessory Protein 4 (REEP4)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Receptor Accessory Protein 4 est non-conjugé

Application: Western Blotting (WB)

Specificité: REEP4 antibody was raised against the N terminal of REEP4

Purification: Affinity purified

Immunogène: REEP4 antibody was raised using the N terminal of REEP4 corresponding to a region with amino acids EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

REEP4 Blocking Peptide, catalog no. 33R-2476, is also available for use as a blocking control in assays to test for specificity of this REEP4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REEP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Receptor Accessory Protein 4

Antigène: Receptor Accessory Protein 4 (REEP4)

Autre désignation: REEP4 (REEP4 Produits)

Synonymes: anticorps C8orf20, anticorps 2700029E10Rik, anticorps RGD1306561, anticorps receptor accessory protein 4, anticorps REEP4, anticorps Reep4

Sujet: REEP4 belongs to the DP1 family. It may enhance the cell surface expression of odorant receptors.

Poids moléculaire: 29 kDa (MW of target protein)