UGCG anticorps (N-Term)

N° du produit ABIN635932

Détail du produit anti-UGCG anticorps

Antigène: UGCG (UDP-Glucose Ceramide Glucosyltransferase (UGCG))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UGCG est non-conjugé

Application: Western Blotting (WB)

Specificité: UGCG antibody was raised against the N terminal of µgCG

Purification: Affinity purified

Immunogène: UGCG antibody was raised using the N terminal of µgCG corresponding to a region with amino acids LHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UGCG Blocking Peptide, catalog no. 33R-5018, is also available for use as a blocking control in assays to test for specificity of this µgCG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UGCG

Antigène: UGCG (UDP-Glucose Ceramide Glucosyltransferase (UGCG))

Autre désignation: UGCG (UGCG Produits)

Synonymes: anticorps GCS, anticorps GLCT1, anticorps XLCGT, anticorps gcs, anticorps glct1, anticorps ugcga, anticorps xlcgt, anticorps cb539, anticorps sb:cb539, anticorps zgc:112506, anticorps ugcg, anticorps ugcgb, anticorps AU043821, anticorps C80537, anticorps Epcs21, anticorps GlcT-1, anticorps Ugcgl, anticorps UDP-glucose ceramide glucosyltransferase, anticorps UDP-glucose ceramide glucosyltransferase L homeolog, anticorps UDP-glucose ceramide glucosyltransferase S homeolog, anticorps UGCG, anticorps ugcg.L, anticorps Ugcg, anticorps ugcg, anticorps ugcg.S

Sujet: Glycosphingolipids (GSLs) are a group of membrane components that contain lipid and sugar moieties. They are present in essentially all animal cells and are believed to have important roles in various cellular processes.

Poids moléculaire: 45 kDa (MW of target protein)