ERMAP anticorps

N° du produit ABIN635933

Détail du produit anti-ERMAP anticorps

Antigène: ERMAP (erythroblast Membrane-Associated Protein (Scianna Blood Group) (ERMAP))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERMAP est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ERMAP antibody was raised using a synthetic peptide corresponding to a region with amino acids PANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ERMAP Blocking Peptide, catalog no. 33R-6968, is also available for use as a blocking control in assays to test for specificity of this ERMAP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERMAP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ERMAP

Antigène: ERMAP (erythroblast Membrane-Associated Protein (Scianna Blood Group) (ERMAP))

Autre désignation: ERMAP (ERMAP Produits)

Synonymes: anticorps AA409279, anticorps AI666418, anticorps PRO2801, anticorps RD, anticorps SC, anticorps erythroblast membrane associated protein (Scianna blood group), anticorps erythroblast membrane-associated protein, anticorps ERMAP, anticorps Ermap

Sujet: The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene.

Poids moléculaire: 52 kDa (MW of target protein)