SLC13A2 anticorps
-
- Antigène Voir toutes SLC13A2 Anticorps
- SLC13A2 (Solute Carrier Family 13 Member 2 (SLC13A2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC13A2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC13 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLD
- Top Product
- Discover our top product SLC13A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC13A2 Blocking Peptide, catalog no. 33R-7231, is also available for use as a blocking control in assays to test for specificity of this SLC13A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC13A2 (Solute Carrier Family 13 Member 2 (SLC13A2))
- Autre désignation
- SLC13A2 (SLC13A2 Produits)
- Synonymes
- anticorps NADC1, anticorps NaCT, anticorps NaDC-1, anticorps SDCT1, anticorps Nadc1, anticorps mucin, anticorps mNaDC-1, anticorps INDY, anticorps nact, anticorps slc13a2, anticorps slc13a5, anticorps wu:fd51b01, anticorps wu:fi13d08, anticorps wu:fi31b05, anticorps zgc:55601, anticorps zgc:77607, anticorps solute carrier family 13 member 2, anticorps solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2, anticorps solute carrier family 13 member 5 L homeolog, anticorps SLC13A2, anticorps Slc13a2, anticorps slc13a5.L, anticorps slc13a2
- Sujet
- SLC13A2 belongs to the SLC13A transporter family, NADC subfamily. It is a multi-pass membrane protein. SLC13A2 cotransports of sodium ions and dicarboxylates such as succinate and citrate.
- Poids moléculaire
- 64 kDa (MW of target protein)
-