SLC5A8 anticorps
-
- Antigène Voir toutes SLC5A8 Anticorps
- SLC5A8 (Solute Carrier Family 5 (Iodide Transporter), Member 8 (SLC5A8))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC5A8 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC5 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC
- Top Product
- Discover our top product SLC5A8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC5A8 Blocking Peptide, catalog no. 33R-3337, is also available for use as a blocking control in assays to test for specificity of this SLC5A8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC5A8 (Solute Carrier Family 5 (Iodide Transporter), Member 8 (SLC5A8))
- Autre désignation
- SLC5A8 (SLC5A8 Produits)
- Synonymes
- anticorps Ait, anticorps SMCT, anticorps SMCT1, anticorps AIT, anticorps RGD1564146, anticorps solute carrier family 5 (iodide transporter), member 8, anticorps solute carrier family 5 member 8, anticorps Slc5a8, anticorps SLC5A8
- Sujet
- SLC5A8 has been shown to transport iodide by a passive mechanism and monocarboxylates and short-chain fatty acids by a sodium-coupled mechanism.
- Poids moléculaire
- 66 kDa (MW of target protein)
-