Tyrosinase-Related Protein 1 anticorps (Middle Region)

N° du produit ABIN635947

Détail du produit anti-Tyrosinase-Related Protein 1 anticorps

Antigène: Tyrosinase-Related Protein 1 (TYRP1)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tyrosinase-Related Protein 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: TYRP1 antibody was raised against the middle region of TYRP1

Purification: Affinity purified

Immunogène: TYRP1 antibody was raised using the middle region of TYRP1 corresponding to a region with amino acids NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TYRP1 Blocking Peptide, catalog no. 33R-6659, is also available for use as a blocking control in assays to test for specificity of this TYRP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TYRP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tyrosinase-Related Protein 1

Antigène: Tyrosinase-Related Protein 1 (TYRP1)

Autre désignation: TYRP1 (TYRP1 Produits)

Synonymes: anticorps CAS2, anticorps CATB, anticorps GP75, anticorps OCA3, anticorps TRP, anticorps TRP1, anticorps TYRP, anticorps b-PROTEIN, anticorps LOC397853, anticorps Trypsin, anticorps hm:zeh0659, anticorps tyrp1, anticorps zgc:100893, anticorps B, anticorps TYRP1, anticorps tyrp-1, anticorps TRP-1, anticorps Tyrp, anticorps b, anticorps brown, anticorps isa, anticorps tyrosinase related protein 1, anticorps protease, serine 1 L homeolog, anticorps tyrosinase-related protein 1b, anticorps tyrosinase-related protein 1, anticorps tyrosinase-related protein 1 L homeolog, anticorps tyrosinase-related protein 1a, anticorps TYRP1, anticorps prss1.L, anticorps tyrp1b, anticorps Tyrp1, anticorps tyrp1.L, anticorps tyrp1, anticorps LOC100136490, anticorps tyrp-1, anticorps tyrp1a

Sujet: TYRP1 catalyses the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. It may regulate or influence the type of melanin synthesized.

Poids moléculaire: 61 kDa (MW of target protein)