B4GALNT1 anticorps (N-Term)
-
- Antigène Voir toutes B4GALNT1 Anticorps
- B4GALNT1 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 1 (B4GALNT1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp B4GALNT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- B4 GALNT1 antibody was raised against the N terminal of B4 ALNT1
- Purification
- Affinity purified
- Immunogène
- B4 GALNT1 antibody was raised using the N terminal of B4 ALNT1 corresponding to a region with amino acids APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG
- Top Product
- Discover our top product B4GALNT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
B4GALNT1 Blocking Peptide, catalog no. 33R-1441, is also available for use as a blocking control in assays to test for specificity of this B4GALNT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- B4GALNT1 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 1 (B4GALNT1))
- Autre désignation
- B4GALNT1 (B4GALNT1 Produits)
- Synonymes
- anticorps MGC53523, anticorps B4GALNT1, anticorps zgc:158609, anticorps GALGT, anticorps GALNACT, anticorps GalNAc-T, anticorps SPG26, anticorps 4933429D13Rik, anticorps Gal-NAc-T, anticorps GalNAcT, anticorps Galgt1, anticorps Ggm-2, anticorps Ggm2, anticorps beta-1,4-N-acetyl-galactosaminyl transferase 1 L homeolog, anticorps beta-1,4-N-acetyl-galactosaminyl transferase 1a, anticorps beta-1,4-N-acetyl-galactosaminyl transferase 1, anticorps Beta-1,4 N-acetylgalactosaminyltransferase 1, anticorps beta-1,4-N-acetyl-galactosaminyltransferase 1, anticorps b4galnt1.L, anticorps b4galnt1a, anticorps b4galnt1, anticorps b4gn1, anticorps B4GALNT1, anticorps B4galnt1
- Sujet
- GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. B4GALNT1(GalNAc-T) catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids.
- Poids moléculaire
- 59 kDa (MW of target protein)
-