PI3 anticorps
-
- Antigène Voir toutes PI3 Anticorps
- PI3 (Peptidase Inhibitor 3, Skin-Derived (PI3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PI3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PI3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAM
- Top Product
- Discover our top product PI3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PI3 Blocking Peptide, catalog no. 33R-4407, is also available for use as a blocking control in assays to test for specificity of this PI3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PI3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PI3 (Peptidase Inhibitor 3, Skin-Derived (PI3))
- Autre désignation
- PI3 (PI3 Produits)
- Synonymes
- anticorps ESI, anticorps SKALP, anticorps WAP3, anticorps WFDC14, anticorps cementoin, anticorps trappin-2, anticorps TRAPPIN-2, anticorps elafin, anticorps peptidase inhibitor 3, anticorps peptidase inhibitor 3, skin-derived (SKALP), anticorps PI3
- Sujet
- PI3 is an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria. PI3 contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. PI3 belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines.
- Poids moléculaire
- 6 kDa (MW of target protein)
-