ST3GAL1 anticorps (C-Term)

N° du produit ABIN635955

Détail du produit anti-ST3GAL1 anticorps

Antigène: ST3GAL1 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 1 (ST3GAL1))

Épitope: C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ST3GAL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ST3 GAL1 antibody was raised against the C terminal of ST3 AL1

Purification: Affinity purified

Immunogène: ST3 GAL1 antibody was raised using the C terminal of ST3 AL1 corresponding to a region with amino acids YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWEN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ST3GAL1 Blocking Peptide, catalog no. 33R-10274, is also available for use as a blocking control in assays to test for specificity of this ST3GAL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ST3GAL1

Antigène: ST3GAL1 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 1 (ST3GAL1))

Autre désignation: ST3GAL1 (ST3GAL1 Produits)

Synonymes: anticorps Gal-NAc6S, anticorps SIAT4A, anticorps SIATFL, anticorps ST3GalA, anticorps ST3GalA.1, anticorps ST3GalIA, anticorps ST3GalIA,1, anticorps ST3O, anticorps 5330418N22Rik, anticorps AI467004, anticorps ST3GalI, anticorps Siat4, anticorps Siat4a, anticorps St3gal-1, anticorps ST3 beta-galactoside alpha-2,3-sialyltransferase 1, anticorps st3gal1, anticorps ST3GAL1, anticorps St3gal1

Sujet: ST3GAL1 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. It is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of ST3GAL1 protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process