Oncostatin M Receptor anticorps (N-Term)
-
- Antigène Voir toutes Oncostatin M Receptor (OSMR) Anticorps
- Oncostatin M Receptor (OSMR)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Oncostatin M Receptor est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- OSMR antibody was raised against the N terminal of OSMR
- Purification
- Affinity purified
- Immunogène
- OSMR antibody was raised using the N terminal of OSMR corresponding to a region with amino acids YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ
- Top Product
- Discover our top product OSMR Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
OSMR Blocking Peptide, catalog no. 33R-10217, is also available for use as a blocking control in assays to test for specificity of this OSMR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSMR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Oncostatin M Receptor (OSMR)
- Autre désignation
- OSMR (OSMR Produits)
- Sujet
- Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells.
- Poids moléculaire
- 110 kDa (MW of target protein)
- Pathways
- Signalistation JAK/STAT, Growth Factor Binding
-