HAS3 anticorps (N-Term)
-
- Antigène Voir toutes HAS3 Anticorps
- HAS3 (Hyaluronan Synthase 3 (HAS3))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HAS3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HAS3 antibody was raised against the N terminal of HAS3
- Purification
- Affinity purified
- Immunogène
- HAS3 antibody was raised using the N terminal of HAS3 corresponding to a region with amino acids GQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVD
- Top Product
- Discover our top product HAS3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HAS3 Blocking Peptide, catalog no. 33R-3489, is also available for use as a blocking control in assays to test for specificity of this HAS3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAS3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HAS3 (Hyaluronan Synthase 3 (HAS3))
- Autre désignation
- HAS3 (HAS3 Produits)
- Synonymes
- anticorps HAS3, anticorps dg42III, anticorps xx:af190743gs1, anticorps xx:af190743gs2, anticorps xhas3, anticorps CHAS3, anticorps hyaluronan synthase 3, anticorps hyaluronan synthase 3 S homeolog, anticorps HAS3, anticorps has3, anticorps Has3, anticorps has3.S
- Sujet
- HAS3 is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. Compared to the proteins encoded by other members of this gene family, this protein appears to be more of a regulator of hyaluronan synthesis.
- Poids moléculaire
- 63 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-