HAS3 anticorps (C-Term)

N° du produit ABIN635963

Détail du produit anti-HAS3 anticorps

Antigène: HAS3 (Hyaluronan Synthase 3 (HAS3))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HAS3 est non-conjugé

Application: Western Blotting (WB)

Specificité: HAS3 antibody was raised against the C terminal of HAS3

Purification: Affinity purified

Immunogène: HAS3 antibody was raised using the C terminal of HAS3 corresponding to a region with amino acids SDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HAS3 Blocking Peptide, catalog no. 33R-8377, is also available for use as a blocking control in assays to test for specificity of this HAS3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HAS3

Antigène: HAS3 (Hyaluronan Synthase 3 (HAS3))

Autre désignation: HAS3 (HAS3 Produits)

Synonymes: anticorps HAS3, anticorps dg42III, anticorps xx:af190743gs1, anticorps xx:af190743gs2, anticorps xhas3, anticorps CHAS3, anticorps hyaluronan synthase 3, anticorps hyaluronan synthase 3 S homeolog, anticorps HAS3, anticorps has3, anticorps Has3, anticorps has3.S

Sujet: HAS3 is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. Compared to the proteins encoded by other members of this gene family, this protein appears to be more of a regulator of hyaluronan synthesis.

Poids moléculaire: 31 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process