ST3GAL3 anticorps (N-Term)

N° du produit ABIN635965

Détail du produit anti-ST3GAL3 anticorps

Antigène: ST3GAL3 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 3 (ST3GAL3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ST3GAL3 est non-conjugé

Application: Western Blotting (WB)

Specificité: ST3 GAL3 antibody was raised against the N terminal of ST3 AL3

Purification: Affinity purified

Immunogène: ST3 GAL3 antibody was raised using the N terminal of ST3 AL3 corresponding to a region with amino acids MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ST3GAL3 Blocking Peptide, catalog no. 33R-6531, is also available for use as a blocking control in assays to test for specificity of this ST3GAL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ST3GAL3

Antigène: ST3GAL3 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 3 (ST3GAL3))

Autre désignation: ST3GAL3 (ST3GAL3 Produits)

Synonymes: anticorps siat6, anticorps st3Gal-III, anticorps st3galii, anticorps st3galiii, anticorps st3n, anticorps SIAT6, anticorps EIEE15, anticorps MRT12, anticorps ST3GALII, anticorps ST3GalIII, anticorps ST3N, anticorps ST3GAL-III, anticorps Siat3, anticorps Siat6, anticorps ST3GALIII, anticorps st3gal3, anticorps zgc:63978, anticorps ST3 beta-galactoside alpha-2,3-sialyltransferase 3 S homeolog, anticorps ST3 beta-galactoside alpha-2,3-sialyltransferase 3, anticorps ST3 beta-galactoside alpha-2,3-sialyltransferase 3a, anticorps st3gal3.S, anticorps ST3GAL3, anticorps St3gal3, anticorps st3gal3a

Sujet: ST3GAL3 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL3 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process