TMED1 anticorps (Middle Region)
-
- Antigène Voir toutes TMED1 Anticorps
- TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMED1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMED1 antibody was raised against the middle region of TMED1
- Purification
- Affinity purified
- Immunogène
- TMED1 antibody was raised using the middle region of TMED1 corresponding to a region with amino acids FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF
- Top Product
- Discover our top product TMED1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMED1 Blocking Peptide, catalog no. 33R-3095, is also available for use as a blocking control in assays to test for specificity of this TMED1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))
- Autre désignation
- TMED1 (TMED1 Produits)
- Synonymes
- anticorps Il1rl1l, anticorps Ly84l, anticorps St2l, anticorps IL1RL1LG, anticorps Tp24, anticorps tmed1, anticorps zgc:92038, anticorps zgc:158680, anticorps transmembrane p24 trafficking protein 1, anticorps transmembrane p24 trafficking protein 1a, anticorps transmembrane p24 trafficking protein 1b, anticorps Tmed1, anticorps TMED1, anticorps tmed1a, anticorps tmed1b
- Sujet
- TMED1 was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.
- Poids moléculaire
- 23 kDa (MW of target protein)
-