ST3GAL2 anticorps (C-Term)

N° du produit ABIN635969

Détail du produit anti-ST3GAL2 anticorps

Antigène: ST3GAL2 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 2 (ST3GAL2))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ST3GAL2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ST3 GAL2 antibody was raised against the C terminal of ST3 AL2

Purification: Affinity purified

Immunogène: ST3 GAL2 antibody was raised using the C terminal of ST3 AL2 corresponding to a region with amino acids ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ST3GAL2 Blocking Peptide, catalog no. 33R-1106, is also available for use as a blocking control in assays to test for specificity of this ST3GAL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ST3GAL2

Antigène: ST3GAL2 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 2 (ST3GAL2))

Autre désignation: ST3GAL2 (ST3GAL2 Produits)

Synonymes: anticorps Gal-NAc6S, anticorps SIAT4B, anticorps ST3GALII, anticorps ST3GalA.2, anticorps AI429591, anticorps AW822065, anticorps ST3GalII, anticorps Siat5, anticorps Siat4b, anticorps siat5, anticorps si:ch211-223o1.7, anticorps ST3GAL2, anticorps siat4-r1, anticorps st3Gal I.1, anticorps ST3GAL-II, anticorps SIAT5, anticorps ST3 beta-galactoside alpha-2,3-sialyltransferase 2, anticorps ST3 beta-galactoside alpha-2,3-sialyltransferase 1, anticorps ST3GAL2, anticorps St3gal2, anticorps st3gal2, anticorps st3gal1

Sujet: ST3GAL2 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process