TMEM115 anticorps (N-Term)

N° du produit ABIN635970

Détail du produit anti-TMEM115 anticorps

Antigène: TMEM115 (Transmembrane Protein 115 (TMEM115))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM115 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM115 antibody was raised against the N terminal of TMEM115

Purification: Affinity purified

Immunogène: TMEM115 antibody was raised using the N terminal of TMEM115 corresponding to a region with amino acids LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM115 Blocking Peptide, catalog no. 33R-5190, is also available for use as a blocking control in assays to test for specificity of this TMEM115 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM115 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM115

Antigène: TMEM115 (Transmembrane Protein 115 (TMEM115))

Autre désignation: TMEM115 (TMEM115 Produits)

Synonymes: anticorps TMEM115, anticorps PL6, anticorps wu:fc43c03, anticorps wu:fd18h12, anticorps zgc:114074, anticorps C78915, anticorps Pl6, anticorps Pp6, anticorps RGD1310540, anticorps transmembrane protein 115, anticorps transmembrane protein 115 S homeolog, anticorps TMEM115, anticorps CpipJ_CPIJ001136, anticorps CpipJ_CPIJ014350, anticorps MCYG_03262, anticorps MGYG_00421, anticorps tmem115.S, anticorps tmem115, anticorps Tmem115

Sujet: The specific function of TMEM115 is not yet known.

Poids moléculaire: 38 kDa (MW of target protein)