NOX1 anticorps (C-Term)
-
- Antigène Voir toutes NOX1 Anticorps
- NOX1 (NADPH Oxidase 1 (NOX1))
-
Épitope
- C-Term
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NOX1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NOX1 antibody was raised against the C terminal of NOX1
- Purification
- Affinity purified
- Immunogène
- NOX1 antibody was raised using the C terminal of NOX1 corresponding to a region with amino acids STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
- Top Product
- Discover our top product NOX1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NOX1 Blocking Peptide, catalog no. 33R-8868, is also available for use as a blocking control in assays to test for specificity of this NOX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NOX1 (NADPH Oxidase 1 (NOX1))
- Autre désignation
- NOX1 (NOX1 Produits)
- Synonymes
- anticorps GP91-2, anticorps MOX1, anticorps NOH-1, anticorps NOH1, anticorps NOX1a, anticorps NOX1alpha, anticorps Nox-1, anticorps Nox1, anticorps NADPH oxidase 1, anticorps NOX1, anticorps Nox1, anticorps nox1
- Sujet
- Voltage-gated proton (hydrogen) channels play an important role in cellular defense against acidic stress. They are unique among ion channels with respect to their extremely high selectivity, marked temperature dependence, and unitary conductance, which is 3 orders of magnitude lower than that of most other ion channels. NOX1 is a homolog of the catalytic subunit of the superoxide-generating NADPH oxidase of phagocytes, gp91phox.
- Poids moléculaire
- 65 kDa (MW of target protein)
- Pathways
- Regulation of Systemic Arterial Blood Pressure by Hormones, Proton Transport
-