Nurim anticorps

N° du produit ABIN635972

Détail du produit anti-Nurim anticorps

Antigène: Nurim (NRM) (Nurim (Nuclear Envelope Membrane Protein) (NRM))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Nurim est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Nurim antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Nurim Blocking Peptide, catalog no. 33R-5708, is also available for use as a blocking control in assays to test for specificity of this Nurim antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Nurim

Antigène: Nurim (NRM) (Nurim (Nuclear Envelope Membrane Protein) (NRM))

Autre désignation: Nurim (NRM Produits)

Synonymes: anticorps NRM29, anticorps 2610307M02Rik, anticorps AI429796, anticorps si:dkey-263h23.2, anticorps nurim, anticorps nurim (nuclear envelope membrane protein), anticorps nurim L homeolog, anticorps NRM, anticorps Nrm, anticorps nrm.L, anticorps nrm

Sujet: The function of Nurim protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 29 kDa (MW of target protein)