TMX2 anticorps (Middle Region)
-
- Antigène Voir toutes TMX2 Anticorps
- TMX2 (Thioredoxin-Related Transmembrane Protein 2 (TMX2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMX2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TXNDC14 antibody was raised against the middle region of TXNDC14
- Purification
- Affinity purified
- Immunogène
- TXNDC14 antibody was raised using the middle region of TXNDC14 corresponding to a region with amino acids IRMGLLYITLCIVFLMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWI
- Top Product
- Discover our top product TMX2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TXNDC14 Blocking Peptide, catalog no. 33R-4138, is also available for use as a blocking control in assays to test for specificity of this TXNDC14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMX2 (Thioredoxin-Related Transmembrane Protein 2 (TMX2))
- Autre désignation
- TXNDC14 (TMX2 Produits)
- Synonymes
- anticorps PDIA12, anticorps PIG26, anticorps TXNDC14, anticorps 2310042M24Rik, anticorps AA589631, anticorps Txndc14, anticorps tmx2, anticorps txndc14, anticorps wu:fb73h06, anticorps zgc:86830, anticorps pig26, anticorps cgi-31, anticorps MGC79568, anticorps DKFZp469G2332, anticorps im:7138651, anticorps zgc:172264, anticorps thioredoxin related transmembrane protein 2, anticorps thioredoxin-related transmembrane protein 2, anticorps thioredoxin-related transmembrane protein 2b, anticorps thioredoxin domain containing 14, anticorps thioredoxin related transmembrane protein 2 S homeolog, anticorps thioredoxin-related transmembrane protein 2a, anticorps TMX2, anticorps Tmx2, anticorps tmx2b, anticorps tmx2, anticorps CpipJ_CPIJ000873, anticorps tmx2.S, anticorps tmx2a
- Sujet
- The function of TXNDC14 has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 34 kDa (MW of target protein)
-