A4GNT anticorps (N-Term)

N° du produit ABIN635981

Détail du produit anti-A4GNT anticorps

Antigène: A4GNT (alpha-1,4-N-Acetylglucosaminyltransferase (A4GNT))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp A4GNT est non-conjugé

Application: Western Blotting (WB)

Specificité: A4 GNT antibody was raised against the N terminal of A4 NT

Purification: Affinity purified

Immunogène: A4 GNT antibody was raised using the N terminal of A4 NT corresponding to a region with amino acids LLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERME

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

A4GNT Blocking Peptide, catalog no. 33R-5167, is also available for use as a blocking control in assays to test for specificity of this A4GNT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 NT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur A4GNT

Antigène: A4GNT (alpha-1,4-N-Acetylglucosaminyltransferase (A4GNT))

Autre désignation: A4GNT (A4GNT Produits)

Sujet: A4GNT is a protein from the glycosyltransferase 32 family. The enzyme catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans. It forms a unique glycan, GlcNAcalpha1-->4Galbeta-->R and is largely associated with the Golgi apparatus membrane.

Poids moléculaire: 39 kDa (MW of target protein)