SDF4 anticorps (Middle Region)
-
- Antigène Voir toutes SDF4 Anticorps
- SDF4 (Stromal Cell Derived Factor 4 (SDF4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SDF4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SDF4 antibody was raised against the middle region of SDF4
- Purification
- Affinity purified
- Immunogène
- SDF4 antibody was raised using the middle region of SDF4 corresponding to a region with amino acids KTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEE
- Top Product
- Discover our top product SDF4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SDF4 Blocking Peptide, catalog no. 33R-4677, is also available for use as a blocking control in assays to test for specificity of this SDF4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDF4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SDF4 (Stromal Cell Derived Factor 4 (SDF4))
- Autre désignation
- SDF4 (SDF4 Produits)
- Synonymes
- anticorps Cab45, anticorps SDF-4, anticorps MGC107861, anticorps wu:fb66d06, anticorps wu:fd46e11, anticorps zgc:56577, anticorps zgc:76916, anticorps CAB45, anticorps stromal cell derived factor 4, anticorps stromal cell derived factor 4 L homeolog, anticorps SDF4, anticorps sdf4, anticorps sdf4.L, anticorps Sdf4
- Sujet
- SDF4 may regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.
- Poids moléculaire
- 39 kDa (MW of target protein)
-