GCNT4 anticorps
-
- Antigène Voir toutes GCNT4 Anticorps
- GCNT4 (Glucosaminyl (N-Acetyl) Transferase 4, Core 2 (Beta-1,6-N-Acetylglucosaminyltransferase) (GCNT4))
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GCNT4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- GCNT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGF
- Top Product
- Discover our top product GCNT4 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GCNT4 Blocking Peptide, catalog no. 33R-8548, is also available for use as a blocking control in assays to test for specificity of this GCNT4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCNT4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GCNT4 (Glucosaminyl (N-Acetyl) Transferase 4, Core 2 (Beta-1,6-N-Acetylglucosaminyltransferase) (GCNT4))
- Autre désignation
- GCNT4 (GCNT4 Produits)
- Synonymes
- anticorps C2GNT3, anticorps C2gnt3, anticorps Gm279, anticorps Gm73, anticorps c2gnt3, anticorps gcnt4, anticorps wu:fc31c11, anticorps glucosaminyl (N-acetyl) transferase 4, core 2, anticorps glucosaminyl (N-acetyl) transferase 4, core 2 (beta-1,6-N-acetylglucosaminyltransferase), anticorps glucosaminyl (N-acetyl) transferase 4, core 2, a, anticorps GCNT4, anticorps Gcnt4, anticorps gcnt4a
- Sujet
- GCNT4 is a glycosyltransferase that mediates core 2 O-glycan branching, an important step in mucin-type biosynthesis. It does not have core 4 O-glycan or I-branching enzyme activity.
- Poids moléculaire
- 53 kDa (MW of target protein)
-