FAM20A anticorps (N-Term)

N° du produit ABIN635991

Détail du produit anti-FAM20A anticorps

Antigène: FAM20A (Family with Sequence Similarity 20, Member A (FAM20A))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM20A est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM20 A antibody was raised against the N terminal of FAM20

Purification: Affinity purified

Immunogène: FAM20 A antibody was raised using the N terminal of FAM20 corresponding to a region with amino acids SKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM20A Blocking Peptide, catalog no. 33R-8558, is also available for use as a blocking control in assays to test for specificity of this FAM20A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM20A

Antigène: FAM20A (Family with Sequence Similarity 20, Member A (FAM20A))

Autre désignation: FAM20A (FAM20A Produits)

Synonymes: anticorps AIGFS, anticorps FP2747, anticorps AI606893, anticorps FAM20A, golgi associated secretory pathway pseudokinase, anticorps family with sequence similarity 20, member A, anticorps FAM20A, anticorps Fam20a

Sujet: The exact function of this gene remains unknown.

Poids moléculaire: 61 kDa (MW of target protein)