QPCTL anticorps (Middle Region)

N° du produit ABIN635992

Détail du produit anti-QPCTL anticorps

Antigène: QPCTL (Glutaminyl-Peptide Cyclotransferase-Like (QPCTL))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp QPCTL est non-conjugé

Application: Western Blotting (WB)

Specificité: QPCTL antibody was raised against the middle region of QPCTL

Purification: Affinity purified

Immunogène: QPCTL antibody was raised using the middle region of QPCTL corresponding to a region with amino acids QLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFML

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

QPCTL Blocking Peptide, catalog no. 33R-7631, is also available for use as a blocking control in assays to test for specificity of this QPCTL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QPCTL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur QPCTL

Antigène: QPCTL (Glutaminyl-Peptide Cyclotransferase-Like (QPCTL))

Autre désignation: QPCTL (QPCTL Produits)

Synonymes: anticorps fb71g05, anticorps si:dkey-149j18.2, anticorps wu:fb71g05, anticorps si:ch211-191j22.6, anticorps gQC, anticorps 1810019P04Rik, anticorps BB101812, anticorps RGD1308128, anticorps glutaminyl-peptide cyclotransferase-like, anticorps glutaminyl-peptide cyclotransferase like, anticorps glutaminyl-peptide cyclotransferase-like a, anticorps glutaminyl-peptide cyclotransferase-like b, anticorps glutaminyl-peptide cyclotransferase, anticorps LOC411943, anticorps QPCTL, anticorps qpctla, anticorps qpctlb, anticorps LOC100163689, anticorps qpctl, anticorps Qpctl

Sujet: QPCTL is a single-pass membrane proteinPotential. It belongs to the glutaminyl-peptide cyclotransferase family. The exact function of QPCTL remains unknown.

Poids moléculaire: 43 kDa (MW of target protein)