TMCO3 anticorps (N-Term)

N° du produit ABIN635995

Détail du produit anti-TMCO3 anticorps

Antigène: TMCO3 (Transmembrane and Coiled-Coil Domains 3 (TMCO3))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMCO3 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMCO3 antibody was raised against the N terminal of TMCO3

Purification: Affinity purified

Immunogène: TMCO3 antibody was raised using the N terminal of TMCO3 corresponding to a region with amino acids KTAIGAVEKDVGLSDEEKLFQVHTFEIFQKELNESENSVFQAVYGLQRAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMCO3 Blocking Peptide, catalog no. 33R-4672, is also available for use as a blocking control in assays to test for specificity of this TMCO3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCO3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMCO3

Antigène: TMCO3 (Transmembrane and Coiled-Coil Domains 3 (TMCO3))

Autre désignation: TMCO3 (TMCO3 Produits)

Synonymes: anticorps C13orf11, anticorps B230339H12Rik, anticorps C87304, anticorps RGD1306586, anticorps transmembrane and coiled-coil domains 3, anticorps TMCO3, anticorps Tmco3, anticorps tmco3

Sujet: TMCO3 belongs to the monovalent cation:proton antiporter 2 (CPA2) transporter family. It is a multi-pass membrane protein. TMCO3 is a probable Na(+)/H(+) antiporter.

Poids moléculaire: 75 kDa (MW of target protein)

Pathways: Proton Transport