TMEM51 anticorps (N-Term)
-
- Antigène Voir toutes TMEM51 Anticorps
- TMEM51 (Transmembrane Protein 51 (TMEM51))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMEM51 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMEM51 antibody was raised against the N terminal of TMEM51
- Purification
- Affinity purified
- Immunogène
- TMEM51 antibody was raised using the N terminal of TMEM51 corresponding to a region with amino acids GFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLVGAGVMLLLLSICLSI
- Top Product
- Discover our top product TMEM51 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMEM51 Blocking Peptide, catalog no. 33R-3264, is also available for use as a blocking control in assays to test for specificity of this TMEM51 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM51 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMEM51 (Transmembrane Protein 51 (TMEM51))
- Autre désignation
- TMEM51 (TMEM51 Produits)
- Synonymes
- anticorps C1orf72, anticorps BC003277, anticorps MGC81093, anticorps RGD1565452, anticorps MGC152450, anticorps fd15a06, anticorps wu:fd15a06, anticorps zgc:171659, anticorps transmembrane protein 51, anticorps transmembrane protein 51 S homeolog, anticorps transmembrane protein 51b, anticorps TMEM51, anticorps Tmem51, anticorps tmem51.S, anticorps tmem51, anticorps tmem51b
- Sujet
- TMEM51 is a multi-pass membrane protein. The function of the TMEM51 protein remains unknown.
- Poids moléculaire
- 28 kDa (MW of target protein)
-