TMTC2 anticorps (N-Term)

N° du produit ABIN635998

Détail du produit anti-TMTC2 anticorps

Antigène: TMTC2 (Transmembrane and Tetratricopeptide Repeat Containing 2 (TMTC2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMTC2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMTC2 antibody was raised against the N terminal of TMTC2

Purification: Affinity purified

Immunogène: TMTC2 antibody was raised using the N terminal of TMTC2 corresponding to a region with amino acids SNSDNPAADSDSLLTRTLTFFYLPTKNLWLLLCPDTLSFDWSMDAVPLLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMTC2 Blocking Peptide, catalog no. 33R-8658, is also available for use as a blocking control in assays to test for specificity of this TMTC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMTC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMTC2

Antigène: TMTC2 (Transmembrane and Tetratricopeptide Repeat Containing 2 (TMTC2))

Autre désignation: TMTC2 (TMTC2 Produits)

Synonymes: anticorps si:ch211-161n3.1, anticorps IBDBP1, anticorps 8430438D04Rik, anticorps D330034A10Rik, anticorps RGD1309848, anticorps transmembrane and tetratricopeptide repeat containing 2a, anticorps transmembrane and tetratricopeptide repeat containing 2 S homeolog, anticorps transmembrane and tetratricopeptide repeat containing 2, anticorps tmtc2a, anticorps tmtc2.S, anticorps TMTC2, anticorps Tmtc2

Sujet: TMTC2 is a multi-pass membrane protein, which contains 10 TPR repeats.It belongs to the TMTC family. The exact function of TMTC2 remains unknown.

Poids moléculaire: 94 kDa (MW of target protein)