Emc7 anticorps (Middle Region)

N° du produit ABIN636001

Détail du produit anti-Emc7 anticorps

Antigène: Emc7 (ER membrane protein complex subunit 7 (Emc7))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Emc7 est non-conjugé

Application: Western Blotting (WB)

Specificité: C15 ORF24 antibody was raised against the middle region of C15 rf24

Purification: Affinity purified

Immunogène: C15 ORF24 antibody was raised using the middle region of C15 rf24 corresponding to a region with amino acids VDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C15ORF24 Blocking Peptide, catalog no. 33R-9464, is also available for use as a blocking control in assays to test for specificity of this C15ORF24 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Emc7

Antigène: Emc7 (ER membrane protein complex subunit 7 (Emc7))

Autre désignation: C15ORF24 (Emc7 Produits)

Synonymes: anticorps si:ch211-150c22.3, anticorps c15orf24, anticorps C10H15orf24, anticorps C15orf24, anticorps C11orf3, anticorps ORF1-FL1, anticorps 2900064A13Rik, anticorps AI451465, anticorps ORF3, anticorps c11orf3, anticorps ER membrane protein complex subunit 7, anticorps emc7, anticorps EMC7, anticorps Emc7

Sujet: The function of C15orf24 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 26 kDa (MW of target protein)