SCUBE2 anticorps (C-Term)

N° du produit ABIN636003

Détail du produit anti-SCUBE2 anticorps

Antigène: SCUBE2 (Signal Peptide, CUB Domain, EGF-Like 2 (SCUBE2))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCUBE2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SCUBE2 antibody was raised against the C terminal of SCUBE2

Purification: Affinity purified

Immunogène: SCUBE2 antibody was raised using the C terminal of SCUBE2 corresponding to a region with amino acids KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SCUBE2 Blocking Peptide, catalog no. 33R-4686, is also available for use as a blocking control in assays to test for specificity of this SCUBE2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCUBE2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SCUBE2

Antigène: SCUBE2 (Signal Peptide, CUB Domain, EGF-Like 2 (SCUBE2))

Autre désignation: SCUBE2 (SCUBE2 Produits)

Synonymes: anticorps CEGB1, anticorps CEGF1, anticorps CEGP1, anticorps 4932442O19Rik, anticorps Cegf1, anticorps Cegp1, anticorps RGD1563998, anticorps Scube2-ps1, anticorps wu:fc27f08, anticorps you, anticorps signal peptide, CUB domain and EGF like domain containing 2, anticorps signal peptide, CUB domain, EGF-like 2, anticorps SCUBE2, anticorps Scube2, anticorps scube2

Sujet: SCUBE2 contains 1 CUB domain and 9 EGF-like domains. The function of the SCUBE2 protein remains unknown.

Poids moléculaire: 110 kDa (MW of target protein)