MANEA anticorps (Middle Region)

N° du produit ABIN636012

Détail du produit anti-MANEA anticorps

Antigène: MANEA (Mannosidase, Endo-alpha (MANEA))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MANEA est non-conjugé

Application: Western Blotting (WB)

Specificité: MANEA antibody was raised against the middle region of MANEA

Purification: Affinity purified

Immunogène: MANEA antibody was raised using the middle region of MANEA corresponding to a region with amino acids KVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MANEA Blocking Peptide, catalog no. 33R-4723, is also available for use as a blocking control in assays to test for specificity of this MANEA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MANEA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MANEA

Antigène: MANEA (Mannosidase, Endo-alpha (MANEA))

Autre désignation: MANEA (MANEA Produits)

Synonymes: anticorps ENDO, anticorps hEndo, anticorps Enman, anticorps 4932703L02Rik, anticorps fi29h09, anticorps zgc:92825, anticorps wu:fi29h09, anticorps mannosidase endo-alpha, anticorps mannosidase, endo-alpha, anticorps MANEA, anticorps Manea, anticorps manea

Sujet: N-glycosylation of proteins is initiated in the endoplasmic reticulum (ER) by the transfer of the preassembled oligosaccharide glucose-3-mannose-9-N-acetylglucosamine-2 from dolichyl pyrophosphate to acceptor sites on the target protein by an oligosaccharyltransferase complex.

Poids moléculaire: 54 kDa (MW of target protein)