TXNDC15 anticorps (C-Term)
-
- Antigène Voir toutes TXNDC15 Anticorps
- TXNDC15 (Thioredoxin Domain Containing 15 (TXNDC15))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TXNDC15 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TXNDC15 antibody was raised against the C terminal of TXNDC15
- Purification
- Affinity purified
- Immunogène
- TXNDC15 antibody was raised using the C terminal of TXNDC15 corresponding to a region with amino acids STRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNV
- Top Product
- Discover our top product TXNDC15 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TXNDC15 Blocking Peptide, catalog no. 33R-8886, is also available for use as a blocking control in assays to test for specificity of this TXNDC15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TXNDC15 (Thioredoxin Domain Containing 15 (TXNDC15))
- Autre désignation
- TXNDC15 (TXNDC15 Produits)
- Synonymes
- anticorps C5orf14, anticorps UNQ335, anticorps 2310047H23Rik, anticorps AI854086, anticorps RGD1304696, anticorps thioredoxin domain containing 15 L homeolog, anticorps thioredoxin domain containing 15, anticorps txndc15.L, anticorps TXNDC15, anticorps Txndc15
- Sujet
- TXNDC15 is a single-pass type I membrane protein. It contains 1 thioredoxin domain.
- Poids moléculaire
- 40 kDa (MW of target protein)
-