UXS1 anticorps (Middle Region)
-
- Antigène Voir toutes UXS1 Anticorps
- UXS1 (UDP-Glucuronate Decarboxylase 1 (UXS1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UXS1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UXS1 antibody was raised against the middle region of UXS1
- Purification
- Affinity purified
- Immunogène
- UXS1 antibody was raised using the middle region of UXS1 corresponding to a region with amino acids LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRH
- Top Product
- Discover our top product UXS1 Anticorps primaire
-
anti-UDP-Glucuronate Decarboxylase 1 (UXS1) antibody
UXS1 Reactivité: Humain, Souris, Rat ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-UDP-Glucuronate Decarboxylase 1 (UXS1) (AA 201-420) antibodyUXS1 Reactivité: Humain ELISA, WB Hôte: Lapin Polyclonal unconjugated
anti-UDP-Glucuronate Decarboxylase 1 (UXS1) (AA 337-366), (C-Term) antibodyUXS1 Reactivité: Humain WB Hôte: Lapin Polyclonal RB33038 unconjugated
anti-UDP-Glucuronate Decarboxylase 1 (UXS1) (C-Term) antibodyUXS1 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Roussette (Chauve-souris), Singe, Porc, Poulet, Xenopus laevis WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UXS1 Blocking Peptide, catalog no. 33R-5205, is also available for use as a blocking control in assays to test for specificity of this UXS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UXS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UXS1 (UDP-Glucuronate Decarboxylase 1 (UXS1))
- Autre désignation
- UXS1 (UXS1 Produits)
- Synonymes
- anticorps SDR6E1, anticorps UGD, anticorps 1600025I13Rik, anticorps AI451869, anticorps AI649125, anticorps AW550562, anticorps CHUNP6891, anticorps fj36b08, anticorps wu:fj36b08, anticorps zgc:91980, anticorps UDP-glucuronate decarboxylase 1, anticorps uxs1, anticorps UXS1, anticorps Ccan_02290, anticorps Uxs1
- Sujet
- UDP-glucuronate decarboxylase catalyzes the formation of UDP-xylose from UDP-glucuronate. UDP-xylose is then used to initiate glycosaminoglycan biosynthesis on the core protein of proteoglycans.
- Poids moléculaire
- 47 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-
