GLT8D2 anticorps (C-Term)

N° du produit ABIN636017

Détail du produit anti-GLT8D2 anticorps

Antigène: GLT8D2 (Glycosyltransferase 8 Domain Containing 2 (GLT8D2))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLT8D2 est non-conjugé

Application: Western Blotting (WB)

Specificité: GLT8 D2 antibody was raised against the C terminal of GLT8 2

Purification: Affinity purified

Immunogène: GLT8 D2 antibody was raised using the C terminal of GLT8 2 corresponding to a region with amino acids IRHLGWNPDARYSEHFLQEAKLLHWNGRHKPWDFPSVHNDLWESWFVPDP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLT8D2 Blocking Peptide, catalog no. 33R-4131, is also available for use as a blocking control in assays to test for specificity of this GLT8D2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLT0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLT8D2

Antigène: GLT8D2 (Glycosyltransferase 8 Domain Containing 2 (GLT8D2))

Autre désignation: GLT8D2 (GLT8D2 Produits)

Synonymes: anticorps si:dkey-22l11.1, anticorps zgc:136873, anticorps 1110021D20Rik, anticorps RGD1560432, anticorps glycosyltransferase 8 domain containing 2, anticorps GLT8D2, anticorps glt8d2, anticorps Glt8d2

Sujet: GLT8D2 belongs to the glycosyltransferase 8 family. The exact function of it remains unknown.

Poids moléculaire: 40 kDa (MW of target protein)