PGAP3 anticorps (N-Term)
-
- Antigène Voir toutes PGAP3 Anticorps
- PGAP3 (Post-GPI Attachment To Proteins 3 (PGAP3))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PGAP3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PERLD1 antibody was raised against the N terminal of PERLD1
- Purification
- Affinity purified
- Immunogène
- PERLD1 antibody was raised using the N terminal of PERLD1 corresponding to a region with amino acids ECMWVTVGLYLQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLV
- Top Product
- Discover our top product PGAP3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PERLD1 Blocking Peptide, catalog no. 33R-2299, is also available for use as a blocking control in assays to test for specificity of this PERLD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PERLD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PGAP3 (Post-GPI Attachment To Proteins 3 (PGAP3))
- Autre désignation
- PERLD1 (PGAP3 Produits)
- Synonymes
- anticorps GB10206, anticorps AGLA546, anticorps CAB2, anticorps PER1, anticorps PERLD1, anticorps PP1498, anticorps D430035D22Rik, anticorps Perld1, anticorps perld1, anticorps pgap3, anticorps post-GPI attachment to proteins factor 3, anticorps post-GPI attachment to proteins 3, anticorps post-GPI attachment to proteins 3 L homeolog, anticorps LOC412085, anticorps PGAP3, anticorps Pgap3, anticorps pgap3.L, anticorps pgap3
- Sujet
- PERLD1 is involved in the lipid remodeling steps of GPI-anchor maturation. Lipid remodeling steps consist in the generation of 2 saturated fatty chains at the sn-2 position of GPI-anchors proteins. It is required for phospholipase A2 activity that removes an acyl-chain at the sn-2 position of GPI-anchors during the remodeling of GPI.
- Poids moléculaire
- 36 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-