GALNT13 anticorps (N-Term)

N° du produit ABIN636022

Détail du produit anti-GALNT13 anticorps

Antigène: GALNT13 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 13 (GalNAc-T13) (GALNT13))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GALNT13 est non-conjugé

Application: Western Blotting (WB)

Specificité: GALNT13 antibody was raised against the N terminal Of Galnt13

Purification: Affinity purified

Immunogène: GALNT13 antibody was raised using the N terminal Of Galnt13 corresponding to a region with amino acids CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GALNT13 Blocking Peptide, catalog no. 33R-1754, is also available for use as a blocking control in assays to test for specificity of this GALNT13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GALNT13

Antigène: GALNT13 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 13 (GalNAc-T13) (GALNT13))

Autre désignation: GALNT13 (GALNT13 Produits)

Synonymes: anticorps si:ch1073-215b15.1, anticorps A230002A12, anticorps A230020F20, anticorps BB182356, anticorps GalNAc-T13, anticorps H_NH0187G20.1, anticorps WUGSC:H_NH0187G20.1, anticorps T13, anticorps polypeptide N-acetylgalactosaminyltransferase 13, anticorps UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13, anticorps polypeptide N-acetylgalactosaminyltransferase 13 S homeolog, anticorps GALNT13, anticorps galnt13, anticorps LOC100544871, anticorps Galnt13, anticorps galnt13.S

Sujet: The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase family, which initiate O-linked glycosylation of mucins by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.

Poids moléculaire: 64 kDa (MW of target protein)