Aquaporin 10 anticorps (C-Term)
-
- Antigène Voir toutes Aquaporin 10 (AQP10) Anticorps
- Aquaporin 10 (AQP10)
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Aquaporin 10 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Aquaporin 10 antibody was raised against the C terminal of AQP10
- Purification
- Affinity purified
- Immunogène
- Aquaporin 10 antibody was raised using the C terminal of AQP10 corresponding to a region with amino acids VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK
- Top Product
- Discover our top product AQP10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Aquaporin 10 Blocking Peptide, catalog no. 33R-9546, is also available for use as a blocking control in assays to test for specificity of this Aquaporin 10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AQP10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Aquaporin 10 (AQP10)
- Autre désignation
- Aquaporin 10 (AQP10 Produits)
- Sujet
- AQP10 is a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. AQP10 was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.
- Poids moléculaire
- 32 kDa (MW of target protein)
-