HS3ST5 anticorps
-
- Antigène Voir toutes HS3ST5 Anticorps
- HS3ST5 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 5 (HS3ST5))
-
Reactivité
- Souris, Rat, Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HS3ST5 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- HS3 ST5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFH
- Top Product
- Discover our top product HS3ST5 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HS3ST5 Blocking Peptide, catalog no. 33R-8735, is also available for use as a blocking control in assays to test for specificity of this HS3ST5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HS3ST5 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 5 (HS3ST5))
- Autre désignation
- HS3ST5 (HS3ST5 Produits)
- Synonymes
- anticorps 3-OST-5, anticorps 3OST5, anticorps HS3OST5, anticorps NBLA04021, anticorps D930005L05Rik, anticorps Gm1151, anticorps Hs3ost5, anticorps HS3ST6, anticorps HS3ST5, anticorps heparan sulfate-glucosamine 3-sulfotransferase 5, anticorps heparan sulfate (glucosamine) 3-O-sulfotransferase 5, anticorps HS3ST5, anticorps Hs3st5, anticorps hs3st5
- Sujet
- HS3ST5 is the rate limiting enzyme for synthesis of HSact. It performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact) that is to complete the structure of the antithrombin pentasaccharide binding site. HS3ST5 also generates GlcUA-GlcNS or IdoUA-GlcNS and IdoUA2S-GlcNH2. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes simplex virus-1 (HSV-1) and permits its entry.
- Poids moléculaire
- 40 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-