LAMP3 anticorps (N-Term)

N° du produit ABIN636028

Détail du produit anti-LAMP3 anticorps

Antigène: LAMP3 (Lysosomal-Associated Membrane Protein 3 (LAMP3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LAMP3 est non-conjugé

Application: Western Blotting (WB)

Specificité: LAMP3 antibody was raised against the N terminal of LAMP3

Purification: Affinity purified

Immunogène: LAMP3 antibody was raised using the N terminal of LAMP3 corresponding to a region with amino acids YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LAMP3 Blocking Peptide, catalog no. 33R-10246, is also available for use as a blocking control in assays to test for specificity of this LAMP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAMP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LAMP3

Antigène: LAMP3 (Lysosomal-Associated Membrane Protein 3 (LAMP3))

Autre désignation: LAMP3 (LAMP3 Produits)

Synonymes: anticorps DC-LAMP, anticorps CD208, anticorps DC LAMP, anticorps DCLAMP, anticorps LAMP, anticorps LAMP-3, anticorps TSC403, anticorps 1200002D17Rik, anticorps Cd208, anticorps lysosomal associated membrane protein 3, anticorps lysosomal-associated membrane protein 3, anticorps LAMP3, anticorps Lamp3

Sujet: LAMP3 might change the lysosome function after the transfer of peptide-MHC class II molecules to the surface of dendritic cells. LAMP3 overexpression is associated with an enhanced metastatic potential and may be a prognostic factor for cervical cancer.

Poids moléculaire: 44 kDa (MW of target protein)