B3GNT7 anticorps (N-Term)

N° du produit ABIN636032

Détail du produit anti-B3GNT7 anticorps

Antigène: B3GNT7 (beta-1,3-N-Acetylglucosaminyltransferase 7 (B3GNT7))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp B3GNT7 est non-conjugé

Application: Western Blotting (WB)

Specificité: B3 GNT7 antibody was raised against the N terminal of B3 NT7

Purification: Affinity purified

Immunogène: B3 GNT7 antibody was raised using the N terminal of B3 NT7 corresponding to a region with amino acids QFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

B3GNT7 Blocking Peptide, catalog no. 33R-7546, is also available for use as a blocking control in assays to test for specificity of this B3GNT7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 NT7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur B3GNT7

Antigène: B3GNT7 (beta-1,3-N-Acetylglucosaminyltransferase 7 (B3GNT7))

Autre désignation: B3GNT7 (B3GNT7 Produits)

Synonymes: anticorps cb543, anticorps ssp1, anticorps beta3GnT7, anticorps C330001H22Rik, anticorps beta-3GnT7, anticorps UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7, anticorps UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 S homeolog, anticorps b3gnt7, anticorps b3gnt7.S, anticorps B3GNT7, anticorps B3gnt7

Sujet: B3GNT7 belongs to the glycosyltransferase 31 family. It may be involved in keratane sulfate biosynthesis. B3GNT7 transfers N-acetylgalactosamine on to keratan sulfate-related glycans. It may play a role in preventing cells from migrating out of the original tissues and invading surrounding tissues.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process