HS6ST3 anticorps (C-Term)

N° du produit ABIN636033

Détail du produit anti-HS6ST3 anticorps

Antigène: HS6ST3 (Heparan Sulfate 6-O-Sulfotransferase 3 (HS6ST3))

Épitope: C-Term

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HS6ST3 est non-conjugé

Application: Western Blotting (WB)

Specificité: HS6 ST3 antibody was raised against the C terminal of HS6 T3

Purification: Affinity purified

Immunogène: HS6 ST3 antibody was raised using the C terminal of HS6 T3 corresponding to a region with amino acids TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HS6ST3 Blocking Peptide, catalog no. 33R-9146, is also available for use as a blocking control in assays to test for specificity of this HS6ST3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HS6ST3

Antigène: HS6ST3 (Heparan Sulfate 6-O-Sulfotransferase 3 (HS6ST3))

Autre désignation: HS6ST3 (HS6ST3 Produits)

Synonymes: anticorps HS6ST-3, anticorps 6OST3, anticorps RGD1560050, anticorps hs6st3, anticorps heparan sulfate 6-O-sulfotransferase 3, anticorps heparan sulfate 6-O-sulfotransferase 3b, anticorps HS6ST3, anticorps Hs6st3, anticorps hs6st3b

Sujet: Heparan sulfate (HS) sulfotransferases, such as HS6ST3, modify HS to generate structures required for interactions between HS and a variety of proteins. These interactions are implicated in proliferation and differentiation, adhesion, migration, inflammation, blood coagulation, and other diverse processes.

Poids moléculaire: 55 kDa (MW of target protein)