B4GALNT3 anticorps (N-Term)
-
- Antigène Tous les produits B4GALNT3
- B4GALNT3 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 3 (B4GALNT3))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp B4GALNT3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- B4 GALNT3 antibody was raised against the N terminal of B4 ALNT3
- Purification
- Affinity purified
- Immunogène
- B4 GALNT3 antibody was raised using the N terminal of B4 ALNT3 corresponding to a region with amino acids NEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTA
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
B4GALNT3 Blocking Peptide, catalog no. 33R-6666, is also available for use as a blocking control in assays to test for specificity of this B4GALNT3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- B4GALNT3 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 3 (B4GALNT3))
- Autre désignation
- B4GALNT3 (B4GALNT3 Produits)
- Synonymes
- anticorps RGD1561056, anticorps AB114826, anticorps B4GalNAcT3, anticorps C330047A21, anticorps beta-1,4-N-acetyl-galactosaminyltransferase 3, anticorps beta-1,4-N-acetyl-galactosaminyl transferase 3, anticorps B4GALNT3, anticorps B4galnt3
- Sujet
- B4GALNT3 transfers N-acetylgalactosamine (GalNAc) onto glucosyl residues to form N,N-prime-diacetyllactosediamine (LacdiNAc, or LDN), a unique terminal structure of cell surface N-glycans. It mediates the N,N'-diacetyllactosediamine formation on gastric mucosa.
- Poids moléculaire
- 115 kDa (MW of target protein)
-