GPR56 anticorps (N-Term)

N° du produit ABIN636036

Détail du produit anti-GPR56 anticorps

Antigène: GPR56 (G Protein-Coupled Receptor 56 (GPR56))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPR56 est non-conjugé

Application: Western Blotting (WB)

Specificité: GPR56 antibody was raised against the N terminal of GPR56

Purification: Affinity purified

Immunogène: GPR56 antibody was raised using the N terminal of GPR56 corresponding to a region with amino acids MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPR56 Blocking Peptide, catalog no. 33R-5594, is also available for use as a blocking control in assays to test for specificity of this GPR56 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR56 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPR56

Antigène: GPR56 (G Protein-Coupled Receptor 56 (GPR56))

Autre désignation: GPR56 (GPR56 Produits)

Synonymes: anticorps fc49b10, anticorps wu:fc49b10, anticorps BFPP, anticorps TM7LN4, anticorps TM7XN1, anticorps Cyt28, anticorps GPR56, anticorps adhesion G protein-coupled receptor G1, anticorps G protein-coupled receptor 56, anticorps ADGRG1, anticorps adgrg1, anticorps Adgrg1, anticorps GPR56

Sujet: GPR56 could be involved in cell-cell interactions.

Poids moléculaire: 76 kDa (MW of target protein)