Antigène Voir toutes GALNT6 Anticorps: GALNT6 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6))
Reactivité 29 6 4 3 3 2 2 2 1 1 1: Humain, Souris, Rat
Hôte 24 5: Lapin
Anticorps secondaires appropriés
Clonalité 27 2: Polyclonal
Conjugué 19 2 2 2 2 2: Cet anticorp GALNT6 est non-conjugé
Application 29 17 5 2 1 1 1 1: Western Blotting (WB)
Purification: Affinity purified
Immunogène: GALNT6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRN
Top Product: Discover our top product GALNT6 Anticorps primaire

GALNT6 Reactivité: Humain WB, ELISA, RNAi Hôte: Souris Monoclonal 4C10 unconjugated

anti-UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6) antibody

GALNT6 Reactivité: Humain WB, IHC, IHC (p), ICC, IF Hôte: Lapin Polyclonal unconjugated

GALNT6 Reactivité: Humain WB, IP Hôte: Lapin Polyclonal unconjugated

GALNT6 Reactivité: Humain, Souris, Chien, Boeuf (Vache), Lapin, Cheval, Singe WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated

GALNT6 Reactivité: Humain, Souris, Chien WB, IHC Hôte: Lapin Polyclonal unconjugated

GALNT6 Reactivité: Humain WB Hôte: Lapin Polyclonal RB36515 unconjugated

GALNT6 Reactivité: Humain WB, ELISA Hôte: Souris Polyclonal unconjugated

GALNT6 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated

GALNT6 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Cobaye WB Hôte: Lapin Polyclonal unconjugated

GALNT6 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Commentaires: GALNT6 Blocking Peptide, catalog no. 33R-2472, is also available for use as a blocking control in assays to test for specificity of this GALNT6 antibody
Restrictions: For Research Use only

Format: Lyophilized
Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT6 antibody in PBS
Concentration: Lot specific
Buffer: PBS
Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Stock: 4 °C/-20 °C
Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigène: GALNT6 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6))
Autre désignation: GALNT6 (GALNT6 Produits)
Synonymes: anticorps 4632410F13, anticorps AW047994, anticorps GalNAc-T6, anticorps fc23d02, anticorps fc56f12, anticorps wu:fc23d02, anticorps wu:fc56f12, anticorps zgc:77836, anticorps GALNAC-T6, anticorps GalNAcT6, anticorps galnac-t6, anticorps galnact6, anticorps polypeptide N-acetylgalactosaminyltransferase 6, anticorps UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6), anticorps GALNT6, anticorps Galnt6, anticorps galnt6
Sujet: GALNT6 is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain.
Poids moléculaire: 71 kDa (MW of target protein)

GALNT6 anticorps

Détail du produit anti-GALNT6 anticorps