ACE2 anticorps
-
- Antigène Voir toutes ACE2 Anticorps
- ACE2 (Angiotensin I Converting Enzyme 2 (ACE2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACE2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ACE2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP
- Top Product
- Discover our top product ACE2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACE2 Blocking Peptide, catalog no. 33R-3121, is also available for use as a blocking control in assays to test for specificity of this ACE2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACE2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACE2 (Angiotensin I Converting Enzyme 2 (ACE2))
- Autre désignation
- ACE2 (ACE2 Produits)
- Synonymes
- anticorps ACE1, anticorps CD143, anticorps DCP, anticorps DCP1, anticorps ICH, anticorps MVCD3, anticorps ACEH, anticorps 2010305L05Rik, anticorps zgc:92514, anticorps angiotensin I converting enzyme, anticorps angiotensin I converting enzyme 2, anticorps angiotensin I converting enzyme (peptidyl-dipeptidase A) 2, anticorps ACE, anticorps ACE2, anticorps Ace2, anticorps ace2
- Sujet
- ACE2 belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this geneuggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63.
- Poids moléculaire
- 89 kDa (MW of target protein)
- Pathways
- ACE Inhibitor Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour
-