GDE1 anticorps (N-Term)
-
- Antigène Voir toutes GDE1 Anticorps
- GDE1 (Glycerophosphodiester Phosphodiesterase 1 (GDE1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GDE1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- GDE1 antibody was raised against the N terminal Of Gde1
- Purification
- Affinity purified
- Immunogène
- GDE1 antibody was raised using the N terminal Of Gde1 corresponding to a region with amino acids LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN
- Top Product
- Discover our top product GDE1 Anticorps primaire
-
anti-Glycerophosphodiester Phosphodiesterase 1 (GDE1) (AA 192-219) antibody
GDE1 Reactivité: Humain, Rat WB, FACS Hôte: Lapin Polyclonal RB37323 unconjugated
anti-Glycerophosphodiester Phosphodiesterase 1 (GDE1) (AA 42-91) antibodyGDE1 Reactivité: Humain, Souris, Rat, Chien, Lapin, Boeuf (Vache), Poisson zèbre (Danio rerio), Cobaye, Hamster, Singe WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Glycerophosphodiester Phosphodiesterase 1 (GDE1) antibodyGDE1 Reactivité: Humain WB Hôte: Souris Monoclonal 2021CT823-61-7 unconjugated
anti-Glycerophosphodiester Phosphodiesterase 1 (GDE1) (AA 31-138) antibodyGDE1 Reactivité: Humain WB, ELISA Hôte: Souris Polyclonal unconjugated
anti-Glycerophosphodiester Phosphodiesterase 1 (GDE1) (AA 1-331) antibodyGDE1 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-Glycerophosphodiester Phosphodiesterase 1 (GDE1) (AA 31-138) antibodyGDE1 Reactivité: Humain ELISA, IF Hôte: Souris Monoclonal 2H6 unconjugated
anti-Glycerophosphodiester Phosphodiesterase 1 (GDE1) (AA 230-242) antibodyVerified GDE1 Reactivité: Souris, Rat WB, ELISA Hôte: Chèvre Polyclonal unconjugated
anti-Glycerophosphodiester Phosphodiesterase 1 (GDE1) (N-Term) antibodyGDE1 Reactivité: Humain, Souris, Rat, Chien, Lapin, Boeuf (Vache), Poisson zèbre (Danio rerio), Cobaye, Cheval WB, IHC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GDE1 Blocking Peptide, catalog no. 33R-5401, is also available for use as a blocking control in assays to test for specificity of this GDE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GDE1 (Glycerophosphodiester Phosphodiesterase 1 (GDE1))
- Autre désignation
- GDE1 (GDE1 Produits)
- Synonymes
- anticorps zgc:56068, anticorps zgc:77135, anticorps 363E6.2, anticorps MIR16, anticorps 1200003M13Rik, anticorps Mir16, anticorps RGS16, anticorps glycerophosphodiester phosphodiesterase 1, anticorps glycerophosphodiester phosphodiesterase 1 L homeolog, anticorps gde1, anticorps gde1.L, anticorps GDE1, anticorps Gde1
- Sujet
- GDE1 has glycerophosphoinositol phosphodiesterase activity. It has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways.
- Poids moléculaire
- 38 kDa (MW of target protein)
-
