Claudin 7 anticorps (C-Term)

N° du produit ABIN636051

Détail du produit anti-Claudin 7 anticorps

Antigène: Claudin 7 (CLDN7)

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Claudin 7 est non-conjugé

Application: Western Blotting (WB)

Specificité: Claudin 7 antibody was raised against the C terminal of CLDN7

Purification: Affinity purified

Immunogène: Claudin 7 antibody was raised using the C terminal of CLDN7 corresponding to a region with amino acids GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Claudin 7 Blocking Peptide, catalog no. 33R-3465, is also available for use as a blocking control in assays to test for specificity of this Claudin 7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Claudin 7

Antigène: Claudin 7 (CLDN7)

Autre désignation: Claudin 7 (CLDN7 Produits)

Synonymes: anticorps cb388, anticorps claudin7, anticorps cldn7, anticorps wu:fd19f08, anticorps MGC53400, anticorps MGC75689, anticorps CLDN7, anticorps CEPTRL2, anticorps CLDN-7, anticorps CPETRL2, anticorps Hs.84359, anticorps claudin-1, anticorps claudin 7b, anticorps claudin 7 L homeolog, anticorps claudin 7, anticorps cldn7b, anticorps cldn7.L, anticorps cldn7, anticorps CLDN7, anticorps Cldn7

Sujet: Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Hepatitis C