IMPG2 anticorps (C-Term)

N° du produit ABIN636052

Détail du produit anti-IMPG2 anticorps

Antigène: IMPG2 (Interphotoreceptor Matrix Proteoglycan 2 (IMPG2))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IMPG2 est non-conjugé

Application: Western Blotting (WB)

Specificité: IMPG2 antibody was raised against the C terminal of IMPG2

Purification: Affinity purified

Immunogène: IMPG2 antibody was raised using the C terminal of IMPG2 corresponding to a region with amino acids VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IMPG2 Blocking Peptide, catalog no. 33R-9875, is also available for use as a blocking control in assays to test for specificity of this IMPG2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IMPG2

Antigène: IMPG2 (Interphotoreceptor Matrix Proteoglycan 2 (IMPG2))

Autre désignation: IMPG2 (IMPG2 Produits)

Synonymes: anticorps IPM200, anticorps RP56, anticorps SPACRCAN, anticorps PG10.2, anticorps Rsbp, anticorps Spacrcan, anticorps Pg10.2, anticorps interphotoreceptor matrix proteoglycan 2, anticorps IMPG2, anticorps Impg2

Sujet: Interphotoreceptor matrix proteoglycan-2 (IMPG2) is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in th e fundus of the eye.

Poids moléculaire: 138 kDa (MW of target protein)