Coagulation Factor X anticorps (C-Term)

N° du produit ABIN636058

Détail du produit anti-Coagulation Factor X anticorps

Antigène: Coagulation Factor X (F10)

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Coagulation Factor X est non-conjugé

Application: Western Blotting (WB)

Specificité: Factor X antibody was raised against the C terminal of F10

Purification: Affinity purified

Immunogène: Factor X antibody was raised using the C terminal of F10 corresponding to a region with amino acids STLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Factor X Blocking Peptide, catalog no. 33R-8874, is also available for use as a blocking control in assays to test for specificity of this Factor X antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of F10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Coagulation Factor X

Antigène: Coagulation Factor X (F10)

Autre désignation: Factor X (F10 Produits)

Synonymes: anticorps FX, anticorps FXA, anticorps Cf10, anticorps fX, anticorps fi12c10, anticorps wu:fi12c10, anticorps F10, anticorps f10, anticorps coagulation factor X, anticorps Coagulation factor X, anticorps coagulation factor 10 L homeolog, anticorps F10, anticorps f10, anticorps CpipJ_CPIJ012712, anticorps CpipJ_CPIJ014863, anticorps CpipJ_CPIJ016937, anticorps CpipJ_CPIJ017791, anticorps fa10, anticorps f10.L

Sujet: F10 is the vitamin K-dependent coagulation factor X of the blood coagulation cascade. This factor undergoes multiple processing steps before its preproprotein is converted to a mature two-chain form by the excision of the tripeptide RKR. Two chains of the factor are held together by 1 or more disulfide bonds, the light chain contains 2 EGF-like domains, while the heavy chain contains the catalytic domain which is structurally homologous to those of the other hemostatic serine proteases. The mature factor is activated by the cleavage of the activation peptide by factor IXa (in the intrisic pathway), or by factor VIIa (in the extrinsic pathway). The activated factor then converts prothrombin to thrombin in the presence of factor Va, Ca+2, and phospholipid during blood clotting.

Poids moléculaire: 29 kDa (MW of target protein)