DAGLB anticorps (Middle Region)

N° du produit ABIN636059

Détail du produit anti-DAGLB anticorps

Antigène: DAGLB (Diacylglycerol Lipase, beta (DAGLB))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DAGLB est non-conjugé

Application: Western Blotting (WB)

Specificité: DAGLB antibody was raised against the middle region of DAGLB

Purification: Affinity purified

Immunogène: DAGLB antibody was raised using the middle region of DAGLB corresponding to a region with amino acids STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DAGLB Blocking Peptide, catalog no. 33R-8863, is also available for use as a blocking control in assays to test for specificity of this DAGLB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAGLB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DAGLB

Antigène: DAGLB (Diacylglycerol Lipase, beta (DAGLB))

Autre désignation: DAGLB (DAGLB Produits)

Synonymes: anticorps DAGLBETA, anticorps KCCR13L, anticorps E330036I19Rik, anticorps RGD1310193, anticorps sn1-specific diacylglycerol lipase beta, anticorps diacylglycerol lipase, beta, anticorps diacylglycerol lipase beta, anticorps LOC472286, anticorps daglb, anticorps DAGLB, anticorps LOC100286527, anticorps LOC100444000, anticorps Daglb

Sujet: DAGLB belongs to the AB hydrolase superfamily.It catalyzes the hydrolysis of diacylglycerol (DAG) to 2-arachidonoyl-glycerol (2-AG), the most abundant endocannabinoid in tissues. This protein is required for axonal growth during development and for retrograde synaptic signaling at mature synapses.

Poids moléculaire: 74 kDa (MW of target protein)