EPHX4 anticorps (N-Term)

N° du produit ABIN636062

Détail du produit anti-EPHX4 anticorps

Antigène: EPHX4 (Epoxide Hydrolase 4 (EPHX4))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EPHX4 est non-conjugé

Application: Western Blotting (WB)

Specificité: ABHD7 antibody was raised against the N terminal of ABHD7

Purification: Affinity purified

Immunogène: ABHD7 antibody was raised using the N terminal of ABHD7 corresponding to a region with amino acids HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABHD7 Blocking Peptide, catalog no. 33R-3705, is also available for use as a blocking control in assays to test for specificity of this ABHD7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EPHX4

Antigène: EPHX4 (Epoxide Hydrolase 4 (EPHX4))

Autre désignation: ABHD7 (EPHX4 Produits)

Synonymes: anticorps ABHD7, anticorps EPHXRP, anticorps Abhd7, anticorps Ephxrp, anticorps Gm1382, anticorps epoxide hydrolase 4, anticorps EPHX4, anticorps Ephx4

Sujet: The specific function of ABHD7 is not yet known.

Poids moléculaire: 42 kDa (MW of target protein)